PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.4093s0018.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family GATA
Protein Properties Length: 315aa    MW: 35094.8 Da    PI: 4.6186
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.4093s0018.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA54.41.7e-17205239135
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                          C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  Cagra.4093s0018.1.p 205 CLHCATEKTPQWRTGPMGPKTLCNACGVRYKSGRL 239
                          99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169922.5E-1011295IPR016679Transcription factor, GATA, plant
SuperFamilySSF577163.66E-15198261No hitNo description
SMARTSM004016.7E-17199249IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.044199235IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.3E-14202237IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.17E-14204251No hitNo description
PROSITE patternPS003440205230IPR000679Zinc finger, GATA-type
PfamPF003202.7E-15205239IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MERLASELFL VAGNTDSFVV DDLLDFSNDD GQVDDGQVDD AFDTFLPDSS TVTLADSSNS  60
SSSFFVDSST GFSGDLCIPS EDLAELEWLS NIVEETFSEE DQDKLHLLSG LKNPQTIGPT  120
QTHQIKPEPE PDFDQFIDTD ESNVAVPAKA RSKRSRSAAS TWASRLLSLA DSSDESNPKK  180
KQRRMANEQD TAVDMDVDCG GGRRCLHCAT EKTPQWRTGP MGPKTLCNAC GVRYKSGRLV  240
PEYRPASSPT FVMARHSNSH RKVMELRRQK EMRDEHVLSQ LRCENLMMDI RSNGEDFLIH  300
NNNNHVAPDF RRLI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1177183PKKKQRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00048PBMTransfer from AT4G32890Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006284030.10.0hypothetical protein CARUB_v10005152mg, partial
SwissprotO826320.0GATA9_ARATH; GATA transcription factor 9
TrEMBLR0H0E90.0R0H0E9_9BRAS; Uncharacterized protein (Fragment)
STRINGfgenesh2_kg.7__840__AT4G32890.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56822749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.11e-141GATA transcription factor 9